PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.8874s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 256aa    MW: 29510.4 Da    PI: 8.3046
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.8874s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.71.1e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Cagra.8874s0001.1.p  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                         79***********************************************96 PP

2K-box93.24.5e-31941761698
                K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                          s+qqe+ kLk++++ Lqr+qR+llGedL++Ls keL++Le+qL++slk+iR+ +++++l+q+++lq ke++l e+nk+Lr +l
  Cagra.8874s0001.1.p  94 SSQQEYLKLKERYDALQRTQRNLLGEDLGPLSSKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRL 176
                          68*****************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-33277IPR002100Transcription factor, MADS-box
CDDcd002655.47E-45277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.93392182IPR002487Transcription factor, K-box
PfamPF014862.7E-2595176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSSMLRTLER YQKCNYGAPE PNVPSREALA VELSSQQEYL KLKERYDALQ RTQRNLLGED  120
LGPLSSKELE SLERQLDSSL KQIRALRTQF MLDQLNDLQS KERMLTETNK TLRLRLADGY  180
QMPLQLNPNP EDHVDHYARH HHQQQQQHSQ AFFQPLECEP ILQIGYQGQQ DHGMGAGPSV  240
NNYMLGWLPY DTNSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-66761791104Developmental protein SEPALLATA 3
4ox0_B2e-66761791104Developmental protein SEPALLATA 3
4ox0_C2e-66761791104Developmental protein SEPALLATA 3
4ox0_D2e-66761791104Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0155520.0AF015552.1 Arabidopsis thaliana MADS-box (AGL9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010499195.11e-173PREDICTED: developmental protein SEPALLATA 3 isoform X1
SwissprotO040671e-171AGL9_SINAL; Agamous-like MADS-box protein AGL9 homolog
TrEMBLA0A087HQT11e-172A0A087HQT1_ARAAL; Developmental protein sepallata 3
STRINGfgenesh2_kg.1__2877__AT1G24260.11e-171(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62202644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.21e-169MIKC_MADS family protein